The URL can be used to link to this page

13-0416_AVI-CON DBA CA CONSTRUCTION_D6_Landscape PlansRTQLGEVOCPCIGT CRRTQXGFD[ FTCYPD[ FCVG UECNG S H E E T LAND CONCERN Landscape Architecture 1750 East Deere Avenue Santa Ana, CA 92705 949.250.4822 REVISIONS S H E E T LAND CONCERN Landscape Architecture 1750 East Deere Avenue Santa Ana, CA 92705 949.250.4822 QH SJC006 FRIENDS OF THELIBRARYSan Juan Capistrano, CALandscape PlansSan Juan Capistrano Library31495 El Camino RealSan Juan Capistrano, CA 9 Friends of the Library Entry Landscape PlansDATERENEWAL DATESIGNATURE* S T A TE OF CALIFORNIA *MICHAEL T. IMLAY LIC . N O . 1494 LICENSED LANDSCAPE AR C H I T E C T V I C I N I T Y M A P L O C A T I O N M A P C O N S U L T A N T S : S H E E T I N D E X : *#4&5%#2')'0'4#.016'5 %QPVTCEVQTVQTGXKGYEQPUVTWEVKQPRNCPUCPFITCFKPIRNCPUVJQTQWIJN[ RTKQTVQDGIKPPKPIYQTM %QPVTCEVQTVQEQPVCEV.CPFUECRG#TEJKVGEVRTKQTVQUVCTVQHEQPUVTWEVKQP HQTRTGÄLQDOGGVKPI#NNQYJQWTUNGCFVKOG %QPVCEV %QPVTCEVQTVQEQPVCEV.CPFUECRG#TEJKVGEVVQTGXKGYJCTFUECRGHQTOKPI RTKQTVQRQWTKPI#NNQYJQWTNGCFVKOG %QPVCEV %QPVTCEVQTUJCNNPQVOCMGHKGNFEJCPIGUVQRNCPUWPNGUUCWVJQTK\GFD[ VJG.CPFUECRG#TEJKVGEV7PCWVJQTK\GFEJCPIGUUJCNNDGEQTTGEVGF VQEQPHQTOVQVJGRNCPUCVPQCFFKVKQPCNEQUVVQVJG1YPGTQT .CPFUECRG#TEJKVGEV %QPVTCEVQTUJCNNXGTKH[NQECVKQPQHCNNWPFGTITQWPFWVKNKVKGUCPFUGTXKEGU RTKQTVQCP[FKIIKPI%QPVTCEVQTCUUWOGUHWNNTGURQPUKDKNKV[HQTCNN FCOCIGECWUGFD[HCKNWTGVQFQUQ %QPVTCEVQTVQRWNNCNNPGEGUUCT[DWKNFKPIRGTOKVUPGGFGFVQEQORNGVG VJGLQD /KMG+ONC[ /KMG+ONC[ %QPVTCEVQTKUVQURQVCNNRNCPVOCVGTKCNCPFJCXGVJG.CPFUECRG #TEJKVGEVCRRTQXGVJGURQVVKPIRTKQTVQGZECXCVKQPQHCP[RNCPVRKV #NNQYJQWTUNGCFVKOG#P[VTGGUJTWDQTXKPGVJCVKURNCPVGF YKVJQWVCRRTQXCNQHVJG.CPFUECRG#TEJKVGEVOC[DGOQXGFCVVJG EQPVTCEVQTUGZRGPUG %QPVCEV 4GOQXGUVCMGUHTQOCNNGURCNKGTUCPFXKPGUCPFCVVCEJVQYCNNU RQUVUGVEYKVJ.CPFUECRG#TEJKVGEVUCRRTQXGFOGVJQF 2TKQTVQRNCPVKPIKPUVCNNCVKQPEQPVTCEVQTUJCNNJCXGUQKNVGUVGFCPF UGPFTGUWNVUVQ.CPFUECRG#TEJKVGEV4GHGTVQRNCPVKPIRNCPHQTUQKN RTGRCTCVKQPDKFKPHQTOCVKQP %QPVTCEVQTVQEQPVCEV.CPFUECRG#TEJKVGEVHQTHKPCNQDUGTXCVKQPYJGP KPUVCNNCVKQPKUEQORNGVGCPFHQTCHKPCNOCKPVGPCPEGQDUGTXCVKQPCVVJG GPFQHVJGOCKPVGPCPEGRGTKQF %QPVCEV .#0&5%#2')'0'4#.016'5 /KMG+ONC[ /KMG+ONC[ #4%*+6'%6 52'%+(+%#6+105.Ä 2'452'%6+8'5 %105647%6+10&'6#+.5 2.#06+0)2.#0 +44+)#6+10&'6#+.5 %105647%6+10&'6#+.5 )4#&+0)2.#0 6+6.'5*''6 &'5%4+26+10 .Ä .Ä .Ä .Ä .Ä .Ä .Ä%1056.#;176 56#-+0)2.#0 .Ä %106#%6 0WPP#TEJKVGEVWTG 8KC2GVTC 5CP,WCP%CRKUVTCPQ%# 4Q[0WPP L:\MODEL GROUP\San Juan Capo Library\CD's\Friends of Library Entry\FriendsofLibrary-Entry_Title.dwg 4'8+5+10&'5%4+26+10 #22418#.5+)0#674'&#6'4'8+5+10 01 Friends of the Library Bookstore Entry Landscape Plans San Juan Capistrano Libray 31495 El Camino Real San Juan Capistrano, CA TITLE SHEET 2GFTQ#3WKLCU L-0 +44+)#6+102.#0#0&016'5.Ä %106#%6 ,COGU)QQFOCP#4%*+6'%674' #XGPKFC(CDTKECPVG5WKVG 5CP%NGOGPVG%# ,KO)QQFOCP READING ALCOVE 109 READING ALCOVE 110 READING ALCOVE 111 ELEC. VEST. 115 CENTERLINE OFDOOR/STEPS3'-0"3'-0" FACE OF EXISTING CURB24"LANDING7'-0" 3'-0"30"CENTERLINEOF WINDOW3'-0"3'-0" FACE OF EXISTING CURB 24"LANDINGFACE OF BUILDING 16"5'-0"5'-0"6"6"6"DET SH-# DET SH-# DET SH-# DET SH-# DET SH-# DET SH-# DET SH-# DET SH-# DET SH-# DET SH-# DET SH-# DET SH-# 1 11 2 EXISTING SIDEWALK P.A. P.A.P.A. P.A. P.A. P.A. 333 3 3 1 B B C C AA 2'-8"2'-8"2'-8"2'-8" DET SH-# EXISTING UTILITY & ENCLOSURE PROTECT IN PLACE EXISTING UTILITY PROTECT IN PLACE 12"DET SH-# 2'-8" 5'-0" 16"EXISTING CONC. EDGEDET SH-# RTQLGEVOCPCIGT CRRTQXGFD[ FTCYPD[ FCVG UECNG S H E E T LAND CONCERN Landscape Architecture 1750 East Deere Avenue Santa Ana, CA 92705 949.250.4822 REVISIONS S H E E T LAND CONCERN Landscape Architecture 1750 East Deere Avenue Santa Ana, CA 92705 949.250.4822 QH SJC006 FRIENDS OF THELIBRARYSan Juan Capistrano, CALandscape PlansSan Juan Capistrano Library31495 El Camino RealSan Juan Capistrano, CA 9 Friends of the Library Entry Landscape PlansDATERENEWAL DATESIGNATURE* S T A TE OF CALIFORNIA *MICHAEL T. IMLAY LIC . N O . 1494 LICENSED LANDSCAPE AR C H I T E C T CONSTRUCTION & INFO PLAN 2GFTQ#3WKLCU Ä L-1 0'2'4'8' Scale: 1/4"=1'-0" Contractor to verify with Landscape Architect all materials, colors, and finishes prior to construction. All construction shall conform to all local City and County codes. All trees, boxed or otherwise, shall be planted prior to any hardscape where conflicts between tree box size and planting area occur. All tree locations and all field adjustments shall be made by the Landscape Architect. All irrigation sleeves shall be installed prior to hardscape. Refer to irrigation plans. All angles to be 90 degrees or 45 degrees unless otherwise noted. All scorelines, sawcuts, and expansion joints to occur as shown on plans. All unlabeled construction joints to be score lines. Contractor shall not make field changes unless authorized by Landscape Architect. Any unauthorized changes shall be corrected to conform to the plans at no additional cost to the owner or Landscape Architect. Contractor to verify all utility locations. Contractor shall inform Superintendent and Landscape Architect if any field modifications are necessary. Paving sub-base and reinforcement to be verified with structural and geotechnical soils engineer. Refer to civil engineer's precise grading plan for drainage locations and details. CONSTRUCTION NOTES General Contractor shall provide on-site 3' x 3' sample flatwork panels for each concrete color / finish combination specified in the paving notes. Sample panels to be approved by Landscape Architect and owner prior to the start of construction. CONCRETE SAMPLE NOTE Scoreline pattern shown for finished design. Trowel release joints may be required initially in some locations as necessary to reduce potential cracking. Trowel joints need to follow scoreline pattern, as shown on the plan, and be finished with a sawcut to match adjacent scoreline sawcuts. Landscape Architect to review all forming before concrete is poured and scoreline "Snap lines" before concrete is cut. Allow 24 hours lead time. CONCRETE FORMING/SCORELINE NOTE PAVING SCHEDULE Concrete Paving Integral colored concrete, color to be: Davis Colors - "Natural Gray". Finish is to be: A Top Cast #3 Violet finish throughout paving area. Scorelines to be sawcut per plan using a double blade. Sawcuts to be 1/2" deep by 1/4" wide. Control joints are to be handscored after pouring concrete using a tool with a tight radius edge. Control joints to be 1-3/4" deep and less than 1/8" wide with tight eased edges. Control Joints are to be sawcut through to match when other joints are sawcut. Concrete Steps Integral colored concrete, color to be: Davis Colors - "Natural Gray". Finish is to be: A Top Cast #5 Violet finish throughout paving area. Scorelines to be sawcut per plan using a double blade. Sawcuts to be 1/2" deep by 1/4" wide. Scores to run down face of treads where occurs. Pea Gravel 3" thick layer of Pea Gravel to be selected by Landscape Architect.over native compacted soil. Enclose with Composite Board header per detail X, on Sheet X. Supplier List: Davis Colors: 800.356.4848 1 2 3 READING ALCOVE 109 READING ALCOVE 110 READING ALCOVE 111 113 ELEC. VEST. 115 RTQLGEVOCPCIGT CRRTQXGFD[ FTCYPD[ FCVG UECNG S H E E T LAND CONCERN Landscape Architecture 1750 East Deere Avenue Santa Ana, CA 92705 949.250.4822 REVISIONS S H E E T LAND CONCERN Landscape Architecture 1750 East Deere Avenue Santa Ana, CA 92705 949.250.4822 QH SJC006 FRIENDS OF THELIBRARYSan Juan Capistrano, CALandscape PlansSan Juan Capistrano Library31495 El Camino RealSan Juan Capistrano, CA 9 Friends of the Library Entry Landscape PlansDATERENEWAL DATESIGNATURE* S T A TE OF CALIFORNIA *MICHAEL T. IMLAY LIC . N O . 1494 LICENSED LANDSCAPE AR C H I T E C T 0'2'4'8' Scale: 1/4"=1'-0" GRADING PLAN 2GFTQ#3WKLCU Ä L-2 Decimal Equivalents 5" = .42 Steps 5 1 2" Unless Otherwise Noted GRADING LEGEND All materials and workmanship to conform to governing codes and ordinances. Contractor to verify grades and notify Landscape Architect of any discrepancies prior to start of grading work. All drain lines to drain 0.5% minimum with smooth continuous fall. All top surfaces of step treads to slope at 1% for drainage. All planting areas are to flow at a minimum of 2% in direction of drains, as noted on plans. All existing grades shown per civil engineer's plans. Hold finish grade a minimum of 3" below top of walls and 6" below finish floors. All finish surfaces to drain at 0.5% min. Unless otherwise noted on plan. All junctions and changes of direction of drainline to be made with 45 degree or sweep elbows. Install deck drains (typ.) per detail ___ sheet ___. See drainage plans for locations. Install catch basins (typ.) per detail ___ sheet ___. See drainage plans for locations. Install atrium drains (typ.) per detail ___ sheet ___. See drainage plans for locations. Contractor is to be aware that existing grade of site is to be accepted as is and both cut and fill may be required in front and rear yards. All drainage devices are to be located as shown on plans. Contractor shall not relocate drainage devices without authorization by the Landscape Architect. Connect all building down spouts and air conditioner condensation lines to the drain system. Contractor to verify in field all locations. GRADING NOTES 4" perforated drain line - Wrap with Mirafi filter fabric. Cover with gravel, 1 C.F. Per L.F. - Connect to drainage system. Catch basin type area drain. Size as noted on plan. Down spout, to be connected to drain system. Verify quantity and location on-site. Area drain w/ green atrium grate. Size as noted on plan. Decorative drain, type and size as noted on plan. Pvc schedule 40, 4" O.D. drainline pipe. Material to comply with City req. Glue all connections. Tree location, typ. See planting plan for type & size. DRAINAGE LEGEND RTQLGEVOCPCIGT CRRTQXGFD[ FTCYPD[ FCVG UECNG S H E E T LAND CONCERN Landscape Architecture 1750 East Deere Avenue Santa Ana, CA 92705 949.250.4822 REVISIONS S H E E T LAND CONCERN Landscape Architecture 1750 East Deere Avenue Santa Ana, CA 92705 949.250.4822 QH SJC006 FRIENDS OF THELIBRARYSan Juan Capistrano, CALandscape PlansSan Juan Capistrano Library31495 El Camino RealSan Juan Capistrano, CA 9 Friends of the Library Entry Landscape PlansDATERENEWAL DATESIGNATURE* S T ATE OF CALIFORNIA *MICHAEL T. IMLAY LIC . N O . 1494 LICENSED LANDSCAPE AR C H I T E C T SCALE: 1 1/2" = 1'-0"SCALE: 3/4" = 1'-0"SHRUB PLANTING SCALE: 3/4" = 1'-0" SCALE: 1" = 1'-0"SCALE: 3/4" = 1'-0"SCALE: 3" = 1'-0" SCALE: X" = 1'-0"SCALE: X" = 1'-0"SCALE: X" = 1'-0" c b a def i h g SLOPE SHRUB PLANTINGCOMPOSITE HEADER CONCRETE STEPS PAVING JOINTS EDGE OF CONCRETE DETAIL NAMEDETAIL NAMEDETAIL NAME CONSTRUCTION DETAILS 2GFTQ#3WKLCU #U5JQYP L-3 1-1/2 X's Rootball diameter Prepare backfill mix per planting notes. 6" Zone of over-excavated and recommended native soil. Shrub rootball, crown shall be flush with finish grade. 3" High water retention basin, rake-out as directed by the landscape architect. Planting fertilizer tablets, per planting notes. Finish grade. Prepare backfill mix per planting notes. Planting fertilizer tablets, per agronomic soils report. Manufactured or existing grade. Water retention basin - to be eliminated when shrubs are native or extremely drought - tolerant species. 1 Times rootball diameter 1" X 6" Composite bender boards to form curved sections. Install per manufacturer's specifications. 2X4 Composite stakes (typ) at 36" o.c. or per manufacturer specifications. 2X6 Composite header - install per manufacturer's specifications. Decorative Pebbles F.G.F.G. STRAIGHT SECTIONSCURVED SECTIONS Composite header boards available from: 'Epic Plastics' Southern CA Rep: O'connor Sales 800.789.3848 Galvanized steel hairpin. Size per manufacturer's specifications. Header joints (plan view) F.G. Min. 3-1/2" thick concrete. For finish and color see construction plan. 1/2" Bullnose tooled edge. Reinforcement per geotech. soils eng. recommendations. Presaturate and compact subgrade per geotech. soils eng.'s recommendations. Contractor to verify all steel reinforcement, sub-grade and concrete thickness with geotechnical soil engineer's recommendations. Contractor to confirm location of thickened edge with geotechnical soil engineer's recommendations. Refer to geotechnical report for recommended thickness and reinforcement. 1/2" deep tooled or saw cut joint - See paving notes Reinforcing per geotech. soils engineer's recommendations E.J. - Expansion Joint Reinforcing per geotech. soils engineer's recommendations C.J. - Cold Joint For paving thickness and reinforcing requirements refer to soil engineer's recommendations. Reinforcing per soils engineer Prepare sub-grade per geotech. soils recommendations (typ.) S.L. - Control Joint Self leveling sealant - 40 shore or greater - color to match adjacent paving tamp silica sand into mastic Concrete paving. See const. info plans for colors & finish 1" 1/2" radius edge (typ) Expansion joint "polyfelt" filler (1/2" x full depth of concrete walk) available from whitecap 1/2" radius edge (typ) Concrete paving Adjacent concrete paving - see const. plan for color & finish 1/2" Rounded edge - typical Integral-color concrete steps - color & finish per construction plan. 2%F.S. F.S. Cold joint Saturate and compact sub-grade per geotechnical soil eng.'s recommendations Expansion joint w/ mastic bead 15" Min. Refer to const. plan RTQLGEVOCPCIGT CRRTQXGFD[ FTCYPD[ FCVG UECNG S H E E T LAND CONCERN Landscape Architecture 1750 East Deere Avenue Santa Ana, CA 92705 949.250.4822 REVISIONS S H E E T LAND CONCERN Landscape Architecture 1750 East Deere Avenue Santa Ana, CA 92705 949.250.4822 QH SJC006 FRIENDS OF THELIBRARYSan Juan Capistrano, CALandscape PlansSan Juan Capistrano Library31495 El Camino RealSan Juan Capistrano, CA 9 Friends of the Library Entry Landscape PlansDATERENEWAL DATESIGNATURE* S T ATE OF CALIFORNIA *MICHAEL T. IMLAY LIC . N O . 1494 LICENSED LANDSCAPE AR C H I T E C T SCALE: 1/4" = 1'-0" SCALE: 1/2" = 1'-0" SCALE: X" = 1'-0"SCALE: 1" = 1'-0" a b i c SECTION A SECTION B SECTION CDETAIL NAME DRAWING NAME DRAWING NAME 0#/' L-4 RTQLGEVOCPCIGT CRRTQXGFD[ FTCYPD[ FCVG UECNG S H E E T LAND CONCERN Landscape Architecture 1750 East Deere Avenue Santa Ana, CA 92705 949.250.4822 REVISIONS S H E E T LAND CONCERN Landscape Architecture 1750 East Deere Avenue Santa Ana, CA 92705 949.250.4822 QH SJC006 FRIENDS OF THELIBRARYSan Juan Capistrano, CALandscape PlansSan Juan Capistrano Library31495 El Camino RealSan Juan Capistrano, CA 9 Friends of the Library Entry Landscape PlansDATERENEWAL DATESIGNATURE* S T A TE OF CALIFORNIA *MICHAEL T. IMLAY LIC . N O . 1494 LICENSED LANDSCAPE AR C H I T E C T SCALE: 1/8" = 1'-0"KEP MAP PERSPECTIVES 0#/' 065 L-5 READING ALCOVE 109 READING ALCOVE 110 READING ALCOVE 111 ELEC. ROOM 113 105 ELEC. VEST. 115 1 2 3 6 4 7 5 2 13 4 a 5 6 7 READING ALCOVE 109 READING ALCOVE 110 READING ALCOVE 111 ELEC. VEST. 115 RTQLGEVOCPCIGT CRRTQXGFD[ FTCYPD[ FCVG UECNG S H E E T LAND CONCERN Landscape Architecture 1750 East Deere Avenue Santa Ana, CA 92705 949.250.4822 REVISIONS S H E E T LAND CONCERN Landscape Architecture 1750 East Deere Avenue Santa Ana, CA 92705 949.250.4822 QH SJC006 FRIENDS OF THELIBRARYSan Juan Capistrano, CALandscape PlansSan Juan Capistrano Library31495 El Camino RealSan Juan Capistrano, CA 9 Friends of the Library Entry Landscape PlansDATERENEWAL DATESIGNATURE* S T A TE OF CALIFORNIA *MICHAEL T. IMLAY LIC . N O . 1494 LICENSED LANDSCAPE AR C H I T E C T IRRIGATION 2GFTQ#3WKLCU Ä L-6 0'2'4'8' Scale: 1/4"=1'-0" IRRIGATION AREA LEGEND Planting area to receive Drip irrigation RTQLGEVOCPCIGT CRRTQXGFD[ FTCYPD[ FCVG UECNG S H E E T LAND CONCERN Landscape Architecture 1750 East Deere Avenue Santa Ana, CA 92705 949.250.4822 REVISIONS S H E E T LAND CONCERN Landscape Architecture 1750 East Deere Avenue Santa Ana, CA 92705 949.250.4822 QH SJC006 FRIENDS OF THELIBRARYSan Juan Capistrano, CALandscape PlansSan Juan Capistrano Library31495 El Camino RealSan Juan Capistrano, CA 9 Friends of the Library Entry Landscape PlansDATERENEWAL DATESIGNATURE* S T ATE OF CALIFORNIA *MICHAEL T. IMLAY LIC . N O . 1494 LICENSED LANDSCAPE AR C H I T E C T IRRIGATION DETAILS 2GFTQ#3WKLCU #U5JQYP L-7 READING ALCOVE 109 READING ALCOVE 110 READING ALCOVE 111 ELEC. VEST. 115 5-5 BJ 5-5 BJ 63-5 LJ 9-5 LJ 34-1 FM 9-5 LJ 34-1 FM 9-5 LJ 43-5 LJ 6-5 BJ 60-1 FM 58-1 FM 108-1 FM RTQLGEVOCPCIGT CRRTQXGFD[ FTCYPD[ FCVG UECNG S H E E T LAND CONCERN Landscape Architecture 1750 East Deere Avenue Santa Ana, CA 92705 949.250.4822 REVISIONS S H E E T LAND CONCERN Landscape Architecture 1750 East Deere Avenue Santa Ana, CA 92705 949.250.4822 QH SJC006 FRIENDS OF THELIBRARYSan Juan Capistrano, CALandscape PlansSan Juan Capistrano Library31495 El Camino RealSan Juan Capistrano, CA 9 Friends of the Library Entry Landscape PlansDATERENEWAL DATESIGNATURE* S T A TE OF CALIFORNIA *MICHAEL T. IMLAY LIC . N O . 1494 LICENSED LANDSCAPE AR C H I T E C T PLANTING PLAN 2GFTQ#3WKLCU Ä L-8 0'2'4'8' Scale: 1/4"=1'-0" FRIENDS OF THE LIBRARY - SHRUB SCHEDULE SYMBOL ABBR.BOTANICAL NAME COMMON NAME SIZE O.C. SPACING WUCOLS BJ Buxus japonica 'Green Beauty'Boxwood 5 Gal.18"' O.C.M FM Festuca mairei Atlas Fescue 1 Gal.24" O.C.L LJ Ligustrum japonicum Japanese Privet 5 Gal.24" O.C.M WUCOLS NOTE: WUCOLS, Water Use Classification of Landscape Species, is a University of California Cooperative Extension publication and is a guide to the water needs of the landscape plants. All boxed trees will be selected by the Landscape Architect. Contact Landscape Architect for name of wholesale nursery. Any tree indicated on a plan should be considered diagrammatic. All local jurisdiction standards and specifications should be reviewed prior to planting. The Contractor shall verify all plant material quality and quantities prior to installation. The Contractor shall be responsible for the continuous protection of all plant materials upon arrival to the site. All trees, shrubs, vines, and groundcovers shall be spotted under the direction of the Landscape Architect and Builder Representative. The placement (spotting) of all plant material is to be reviewed in the field with the Landscape Architect prior to planting. Any tree or shrub that is planted without prior review may be subject to transplant if it is deemed to be in the wrong position. The Landscape Contractor is responsible for the correct height of plant material above grade. Adjustments to tree locations are to be made if there is a conflict with subsurface drain lines or storm drains. All specimen trees are to be fine pruned after planting. Thirty (30) days after installation, all landscape areas shall be fertilized with a commercial grade fertilizer of 16-6-8 or approved equal, applied at the rate of 6 lbs. per sq. ft. Fertilizer application shall be continuous thereafter at monthly intervals. During the last 30 days of maintenance, the Builder is responsible for obtaining as builts, controller charts and watering schedules from his Landscape Contractor. Three copies are to be submitted to the master or sub association and Maintenance Contractor. GENERAL PLANTING NOTES Espaliered Gallon Container Ground Cover Height Landscape Architect Landscape Contractor Minimum Multi-trunked On Center Redwood Selected by L.A. Specimen Spread Standard ESP. GAL. G.C. HT. L.A. L.C. MIN. M.T. O.C. RWD. S.L.A. SPEC. SP. STD. RIS 5-5 PLANTING KEY See Legend Quantity Size of plant, gallon or box size PLANTING LEGEND Contractor to note that the quantities on legends and plant call-outs have been provided for quick reference only. It is recommended that the Contractor not rely on the accuracy of these quantities and provide their own plant material counts at the time of preparing bid. Any discrepancy in plant quantities and sizes should be brought to the immediate attention of the Landscape Architect. QUANTITIES This note is for "BID PURPOSE ONLY". Contractor shall be responsible for obtaining an agronomic soils report and soil amendment recommendations per agronomist. If surface soil compaction has occurred, to extent possible, all areas to be landscaped should be cross ripped or otherwise tilled to a depth of 9-12 inches. For turf and groundcover planting, the following amendments should be uniformly broadcast and thoroughly incorporated to a 6" depth by means of rototiller or equal: 6 cu. yds. Nitrogen stabilized organic amendment derived from redwood, fir or cedar sawdust. 15 lbs. 12-12-12 commercial fertilizer. 10 lbs. soil sulfur Since soil sulfur is included in the pre-plant program, care should be taken in order to insure that all amendments are thoroughly incorporated to the depth specified. The backfill mix for use around the rootball of container grown trees and shrubs should be prepared as follows: 6 parts by volume on-site soil 4 parts by volume Nitrogen stabilized organic amendment 1 lb. 12-12-12 per cu. yd. of mix 2 lbs. Iron Sulfate per cu. yd. of mix The above materials should be thoroughly blended prior to use for backfill purposes. The Iron Sulfate should not contact cement surfaces at any time, or severe staining will occur. SOIL AMENDMENTS 2" Thick covering of "forest floor" shredded bark mulch in all flat (3:1 or less) planting areas Except at sodded areas. Slopes to receive 2" thick covering of mulch where specified on plan. Contractor to send sample to landscape architect. Available From: Aguinaga Fertilizer Company (949) 786-9558 MULCH NOTE RTQLGEVOCPCIGT CRRTQXGFD[ FTCYPD[ FCVG UECNG S H E E T LAND CONCERN Landscape Architecture 1750 East Deere Avenue Santa Ana, CA 92705 949.250.4822 REVISIONS S H E E T LAND CONCERN Landscape Architecture 1750 East Deere Avenue Santa Ana, CA 92705 949.250.4822 QH SJC006 FRIENDS OF THELIBRARYSan Juan Capistrano, CALandscape PlansSan Juan Capistrano Library31495 El Camino RealSan Juan Capistrano, CA 9 Friends of the Library Entry Landscape PlansDATERENEWAL DATESIGNATURE* S T A TE OF CALIFORNIA *MICHAEL T. IMLAY LIC . N O . 1494 LICENSED LANDSCAPE AR C H I T E C T CONCRETE 1. SCOPE Furnish and install all concrete work complete as indicated on the drawings and specified including: A. Furnish and set all reinforcing steel, bolts, and anchors. B. Install all items required by other trades which are to be cast into concrete. C. Concrete mow strips, footings for: walls, fencing, benches, etc., where applicable. 2. GENERAL All requirements of subsection 3.3.1, standard specifications for Public Works construction, shall apply except as specified herein. 3. MATERIALS A. Portland cement shall conform to ASTM-C150, Type IV. B. Concrete aggregate shall conform to ASTM-C33. C. Water shall be clean, free from strong acids, alkali, oil or organic matter. D. Add mixture for all formed concrete shall be SIKA Chemical Corp's "Plastiment," or approved equal, applied in strict accordance with manufacturer's directions. E. Reinforcement: Reinforcing steel ASTM-A615 and A615M-08A. Wire fabric: ASTM-A185. F. Form 1. Lumber shall be "Construction Grade," Douglas Fir. 2. Plywood for forming of concrete which is exposed shall be plyform. All plywood used for forming shall be at least 5/8-inch thick and edge sealed. G. Expansion joint filler shall conform with ASTM-D1751 (premolded). 4. CONCRETE A. Quality 1. The Contractor shall assume responsibility for all the design mix and shall guarantee the specified ultimate strength as indicated or specified herein. 2. Concrete, to be type V and the minimum 28 day ultimate strength shall be 4,500 psi. This is to be verified by the project soil engineer. 3. Ready-mixed concrete shall conform to ASTM-C94. B. Proportions and Consistency 1. The proportions of aggregate to cement shall provide a dense mixture which will readily work into all corners of the forms and around all reinforcements without any segregation of the materials, cause excess free water to collect on the surface or cause excessive bleeding of the forms. 2. The recommended practices of the American Concrete Institute shall be followed in all applicable procedures. The maximum slump shall not exceed 3 inches for footings, slabs ongrade, and mass concrete; 5 inches for foundation walls. C. Control The concrete quality, proportions, consistency, etc., is subject to the approval of the Owner, and no changes shall be made without his prior written approval. 5. FORM WORK A. Forms for concrete work shall be either metal or wood. Forms that are warped or that do not have a smooth straight upper edge shall not be used. Forms shall be set with the upper edge of the board true to line and grade and shall be staked rigidly in place with stakes set not more than four feet (4') apart so as to remain immovable throughout the construction. All forms shall be approved by County within a tolerance of one percent (1%). All materials shall be accurately and separately weighed and mixing shall continue until the distribution of materials is uniform and the mass of concrete is homogeneous. B. Two and one-half (2-1/2) gallons of water per cubic yard, shall be withheld from the mix at the plant, and all or a portion may be added to the mix at the job site as directed by the Inspector. The concrete shall be mixed at least 5 minutes after such water is added and not less than 3 minutes of the time shall be immediately prior to the discharge of the batch. Total mixing time after adding original water shall be at least 15 minutes. C. Concrete which is not placed within 90 minutes after the introduction of cement and water, and concrete which has stood for 30 minutes after leaving the mixer, shall not be used. 6. CONVEYING AND PLACING A. Before pouring, all forms shall be thoroughly cleaned and made tight. The bottom of trenches shall be wet down before pouring footings; earth shall not be muddy at the time of pouring. Concrete shall not be placed until reinforcements, rough hardware, and forms are approved by Owner, Landscape Architect, and appropriate government agency. B. Before depositing new concrete against old concrete, all laitance shall be removed and the surfaces roughened to expose the embedded aggregate. The surfaces shall then be covered with cement grout, using the specified mix with 1/2 of the course aggregate omitted, 1-1/2 inches thick. C. Conveying and placing of concrete shall be done so as to prevent separation of ingredients, and in no case shall the free fall exceed 6 feet. Tremies shall be used as required. Surfaces of concrete shall be kept reasonably level, with a minimum amount of concrete being allowed to flow after being placed. Placing shall be performed as a continuous until each section is completed. 7. GROUT A. Grout shall be composed of one part Portland Cement and two parts of fine aggregate by volume. Materials shall be mixed dry and water added just sufficient to make the mixture flow under its own weight. B. For dry tamp cement grout, a minimum of water shall be added to the mix so that when set sample is squeezed hard in the hand, surface moisture, but no free water shall appear on the sample. Do not mix more than can be used in 30 minutes. 8. CURING AND PROTECTION A. All exposed surfaces of concrete shall be protected from damage due to temperature, elements, and construction operations. B. Curing 1. All exposed surfaces of concrete shall be protected from premature drying, and freshly placed concrete shall be protected against wash by rain. All concrete shall be kept wet for a period of ten days after placing. In order that curing water may reach both surfaces of walls, the forms shall be loosened and water shall be poured over the tops of the walls and allowed to run down between the concrete and the forms. 2. All liquid curing compounds shall be used in accordance with the manufacturer's recommendations and shall not be used on surfaces receiving concrete hardener. 9. DEFECTIVE CONCRETE A. Concrete which is not in accordance with these specifications, out of line, level or plumb; showing structure cracks, rock pockets and honeycombing shall be patched with dry pack concrete. B. All fins and irregularities shall be removed from exposed concrete surfaces while the concrete is still green. Where patching is required, all loose and uniform concrete shall be removed prior to patching. Minor rock pockets and onof honeycoming shall be patched with dry pack concrete. 10. CONCRETE FINISHES A. Flat surfaces shall be screeded to the required levels and slopes and then any excess water and laitance removed. Concrete shall be compacted with a grid tamper and then floated to a true and level surface within the tolerance of 1/8 inch along a 10-inch straight edge. B. See plans for concrete finish in landscape areas. 11. EXPANSION JOINTS Placement of expansion joints shall be as directed and determined by layouts of slab markings noted "E.J." on drawings. Expansion joint materials shall be Poly Foam and the joint is to be caulked to match the paving. 12. PROTECTION All finished concrete work shall be barricade to pedestrian traffic for three (3) days. Barricades shall be placed immediately after concrete finishing. Contractor shall furnish, place, and remove all of his own barricades. Contractor shall be responsible for any damage to new construction, and replacement or repair of the work shall be made without added cost to Owner. 13. PATCHING If patching is necessary and permissible, a bonding agent such as Weld-Crete, or equal, shall be used. 14. CONCRETE CURBS Construct concrete curbs at locations shown on plans as detailed, true to line and grade, as approved by the local County or City. Use natural grey Portland cement concrete, 2,000psi compressive strength. Locate expansion joints as detailed or shown, and as directed, at intervals not to exceed fifteen feet (15'). Finish with steel trowel, then brush with bristle brush parallel to face or edge. 15. CLEAN UP Upon completion of all concrete work and before final acceptance, Contractor shall remove all tools, surplus materials, apparatus, debris, etc., from the site and the site shall be left in a clean, neat condition acceptable to Owner. LANDSCAPE CONSTRUCTION 1. SCOPE OF WORK The work of this section includes all labor, materials, and equipment required to complete work indicated on the drawings. The work shall be performed in accordance with the best standards of practice relating to the various trades and under the continuous supervision of a competent foreman, capable of interpreting the drawings and these specifications. The work included in the section is as follows: Finish Grading for Planting, Soil Preparation, Fertilization, Planting, including lawn, Maintenance, Inspection and Certifications, Guarantees, Cleanups, Staking, Guying and Espaliering and Miscellaneous Allowances. 2. APPROVALS A. All sprinkler work shall be inspected and approved prior to the start of any work in this section. B. Prior to excavation for planting or placing of stakes, locate all utilities, electric cables, conduits, sprinkler lines, heads, valves and valve control wires, and all utility lines so that proper precautions may be taken not to damage such improvements. In the event of a conflict between such lines and plant locations, promptly notify the Landscape Architect who shall arrange for relocation for one or the other. Failure to follow this procedure places upon the Contractor the responsibility for, at his own expense, making any and all repairs for damages resulting from work thereunder. LANDSCAPE CONSTRUCTION (Continued) 3. QUANTITIES AND TYPES: Plant materials shall be furnished in the quantities and/or spacing as shown or noted for each locations, and shall be of the species, kinds, sizes, etc., as symbolized and/or described in the "Plant Legend" as indicated on the drawings. The Landscape Architect has prepared this list only as a convenience to the Contractor and assumes no responsibility for its accuracy. The Landscape Contractor is to verify all sizes and quantities. 4. VERIFICATION OF DIMENSIONS AND QUANTITIES: All scaled dimensions are approximate. Before proceeding with any work, the Contractor shall carefully check and verify all dimensions and quantities and shall immediately inform the Landscape Architect and Owner of any discrepancy between the drawings and/or specifications and actual conditions. No work shall be done in any area where there is such a discrepancy until approval for the same has been given by the Landscape Architect and Owner. 5. INSPECTION A. All inspections shall be made by the Landscape Architect and the Owner. The Contractor shall request inspection at least two (2) days in advance of the time inspection is required. B. Inspection will be required for the following parts of the work: 1. During finish grading and soil preparation. 2. Plants, after delivery to site prior to planting. 3. When vines, shrubs, and trees are spotted for planting, but holes are not excavated. 4. Specimen trees at source, before delivery. 5. Lawn areas prior to planting. 6. Planting areas prior to planting. 7. All landscape construction items, prior to the start of the calendar day maintenance period (final observation). 8. At completion of calendar day maintenance period (final maintenance observation). 9. Inspection reports shall be made for each observation by the Landscape Architect and one copy shall be submitted to the Owner and the Contractor. 6. CERTIFICATION A. Prior to job acceptance, written certifications shall be submitted to the Landscape Architect, for the following: 1. Quantity and quality of commercial fertilizer and organic fertilizer. 2. Quantity and quality of all soil amendments called for by plans and specifications. 7. MATERIALS A. Plant materials indicated on the drawings and herein specified, shall conform to the following: 1. Nomenclature: Plant names indicated or listed in the "Plant Legend" on the drawings, conform to "Standard Plant Names" established by the American Joint Committee On Horticulture. Except for names covered therein, the established custom of the nursery is followed. 2. Condition: Plants shall be symmetrical, typical for variety and species, sound, healthy, vigorous, free from plant disease, insect pests, insect eggs and any objectionable disfigurements and shall have healthy, normal root systems, well filling their containers, but not to the point of being root bound. Plants shall not be pruned prior to delivery, except as authorized by the Landscape Architect, or his representative. In no case shall trees be opened before delivery. 3. Dimension: The height and spread of all plant material shall be measured with branches in their normal position and shall be as indicated on the drawings. The caliper of all trees shall be measured four feet (4'-0") above the surface of the ground. Where caliper or other dimensions of any plant material are omitted from the "Plant Legend," it shall be understood that these plant materials shall be normal stock for type listed. 4. Nursery Care: All plants shall be grown using recognized horticutural practices. Proper fertilization, staking, and spraying shall be done accordingly. All nurseries providing plant material shall be in compliance with all applicable federal, state and county programs. 5. Inspection: All plant materials must have been previously inspected at the nursery, and shall be subject to the inspection and approval of the Landscape Architect before planting. 6. Plant List: As indicated on drawings. 7. Sizes of Plants: Shall be as stated on the plan. Container stock (1-gallon, 5-gallon, and 15-gallon) shall have been grown in containers for at least one (1) year, but not over two years. 8. Substitutions: Substitutions for the indicated plant materials will be permitted provided the substitute materials are approved in advance by the Landscape Architect and the substitutions are made at no cost to the Owner. Except for the variations so authorized, all substitute plant materials shall conform to the requirements of these specifications. If the accepted substitute materials are of less value than those indicated or specified, the contract price will be adjusted in accordance with the provisions of the contract. 9. Plants Not Approved: Plants not approved are to be removed from site immediately and replaced with suitable plants. The Landscape Architect and/or Owner reserves the right to reject entire lots of plants represented by defective samples. 8. FERTILIZERS AND SOIL CONDITIONERS: A. This note is for "BID PURPOSE ONLY". Contractor shall be responsible for obtaining an agronomic soils report and soil amendment recommendations per agronomist. 1. If surface soil compaction has occurred, to extent possible, all areas to be landscaped should be cross ripped or otherwise tilled to a depth of 9-12 inches. 2. For turf and groundcover planting, the following amendments should be uniformly broadcast and thoroughly incorporated to a 6" depth by means of rototiller or equal: 6 cu. yds. Nitrogen stabilized organic amendment derived from redwood, fir or cedar sawdust. 15 lbs. 12-12-12 commercial fertilizer. 10 lbs. soil sulfur 3. Since soil sulfur is included in the pre-plant program, care should be taken in order to insure that all amendments are thoroughly incorporated to the depth specified. The backfill mix for use around the rootball of container grown trees and shrubs should be prepared as follows: 6 parts by volume on-site soil 4 parts by volume Nitrogen stabilized organic amendment 1 lb. 12-12-12 per cu. yd. of mix 2 lbs. Iron Sulfate per cu. yd. of mix 4. The above materials should be thoroughly blended prior to use for backfill purposes. The Iron Sulfate should not contact cement surfaces at any time, or severe staining will occur. 5. Commercial fertilizer added to backfill mix shall be Agriform 21 gram tablets (22-10-5). Refer to planting plans for the quantities used per plants. 9. STAKING MATERIALS: A. Tree staking shall be as per plan. B. Ties for holding trees shall be as per detail. 10. GRADING AND SOIL PREPARATION: A. Contractor is to finish grade to within 1/10th of 1 foot or 1" below paving where paving exists. B. Moisture Content: The soil shall not be worked when the moisture content is so great that excessive compaction will occur, not when it is so dry that dust will form in the air or that clods will not break readily. Water shall be applied if necessary to provide ideal moisture content for tilling and for planting herein specified. C. Preliminary Grading: Preliminary grading shall be done in such a manner to anticipate the finish grading. Excess soil shall be removed or redistributed before application of fertilizer and mulch. Where soil is to be replaced by plants and mulch, allowance shall be made so that when finish grading has begun, there shall be no deficiency in the specified depth of mulched planting beds. D. Weeding: Before and during preliminary and finish grading, weeds and grasses shall be dug out by the roots and disposed of off the site (except those weeds and grasses not of the perennial type, less than 2-1/2" and not bearing seeds, which may be turned under). Oats more than 2-1/2" high and not bearing seeds may be turned under. Perennial weeds and grasses to be removed include, but are not limited to, the following: Nut Grass Puncture Vine Dallas Grass Mustard Plant St. Augustine Grass Alfalfa Johnson Grass Wire Weed Morning Glory E. All planting areas shall be scarified to a depth of 12 inches below grade with the spacing of the ripper teeth no greater than 12 inches on center prior to placing conditioners and fertilizers. All rocks and debris more than 2" in diameter shall be removed from the site. F. Trenches: If sprinkler system is installed after grading and fertilizing is completed, the upper portion of the back fill shall be retilled and fertilized to the depth specified for the area required to conform to the specifications. 11. FINISH GRADING When preliminary grading, including weeding and fertilizing, has been completed and the soil has dried sufficiently to be readily worked, all lawn and planting areas shall be graded to the elevations indicated on the drawings. Grades not otherwise indicated shall be uniform levels or slopes between points where elevations are given. Minor adjustments of finish grades shall be made at the direction of the Landscape Architect, if required. Finish grade shall be smooth, even, and uniform plane without abrupt change of surface. Soil areas adjacent to buildings to allow a natural run-off of water, and surface drainage shall be directed as indicated on drawings by remodeling surfaces to facilitate the natural "run-off" of water. Low spots and pockets shall be one inch (1") below grade of adjacent pavement of any kind. Grading shall be done when soil is at optimum moisture content for working. 12. METHOD OF PLANTING AND WORK PROCEDURE A. No planting shall be done until all operations in conjunction with the installation of the sprinkler system have been completed, final grades have been established, the planting areas have been properly graded and prepared as herein specified, and the work approved by the Landscape Architect. B. The relative position of all trees and plants is subject to approval by the Landscape Architect and Owner, and they shall if necessary, be relocated as directed as part of the Contract. C. All plants shall be removed from their containers and set so that, when settled, they bear the same relation to the required grade that they bore to the natural grade before being transplanted. Each plant shall be planted in the center of the pit and backfilled unless otherwise specified, with the prepared soil. No soil in muddy condition shall be used for backfilling. No filling will be permitted around trunks or stems. All broken or frayed roots shall be properly cut off. D. The Landscape Architect and/or Owner shall inspect the placing and planting of all plant materials. E. In the event that underground construction work or obstructions are encountered in the planting operation, alternate locations for plant material will be selected by the Landscape Architect and Owner, operation will be at no extra cost to the Owner. LANDSCAPE CONSTRUCTION (Continued) 13. PLANTING OF TREES A. Position plants in plant location indicated on drawings and secure approval before excavating pits, making necessary adjustments as indicated. B. All pits for trees shall be dug square with bottom level, the plant pit size shall be dug per the following site conditions: i. Tree planting in flat areas: The width of the planting pit shall be two and one half times the rootball width. The depth of the planting pit shall be the depth of the rootball plus six inches. ii. Tree planting on slopes: The width of the planting pit shall be one and one half times the rootball width. The depth of the planting pit shall be the depth of the rootball plus six inches. Compacted soils at sides and bottoms shall be loosened by scarifying or other approved method. Pits shall be backfilled with "prepared soil" to the required grade, and the balance of the pit filled with "prepared soil", thoroughly settled by water application. C. Set plants in the center of pit, in vertical position, so that crown of ball will be level with finish grade after allowing for watering and settling and shall bear the same relationship to the finish grade that it did to the soil surface in the container. D. Prepare a depressed water basin as wide as plant balls at each plant. Water thoroughly, backfilling any voids with additional prepared planting mix. 14. PLANTING VINE, SHRUBS AND GROUNDCOVERS. A. Vines and shrubs shall be planted in pits as indicated by the following site conditions: i. Vines and shrubs in flat areas: The width of the planting pit shall be one and one half times the width of the rootball. The depth of the planting pit shall be the depth of the rootball plus six inches. ii. Vines and shrubs on slopes: The width of the planting pit shall be the width of the rootball. The depth of the planting pit shall be the depth of the rootball plus six inches. Compacted soil at bottom of bit shall be loosened and the pit filled with "prepared soil" to the bottom of the ball. When the plant has been properly set, the pit shall be filled to the required grade with "prepared soil" and thoroughly settled by tamping and watering. All vines shall be removed from stakes, united, and securely fastened in the approved manner to the wall, fence or other surface next to which they are planted. B. Prepare a depressed water basin as wide as plant balls at each plant. Water thoroughly, backfilling any voids with additional prepared planting mix. C. Ground Covers: 1. Pits or flats sized plant to be at least 6"x6"x6". Ground cover areas shall be moistened prior to planting. No flat plants shall be planted in dry soil. 2. Set plants in center of pits so that crown of plant will be level with finished grade after settling of soil, then backfill and water. 3. Flatted plants shall be well-rooted with runners at least 4" but not more than 6" in length. 15. TREES AND VINE OCCURRING IN LAWN Trees and vines occurring in lawn shall be planted before final preparation of those areas. 16. CARE OF PLANTS BEFORE AND DURING PLANTING Plants shall not be allowed to dry out before or while being planted. Keep exposed roots moist by means of wet sawdust, peat moss, or burlap at all times during planting operations. Do not expose roots to the air except while being placed in the ground. Wilted plants, whether in place or not, will not be accepted and shall be replaced at the Contractor's expense. 17. WATERING BASINS A. Construct a fully compacted mound of soil around each tree and plant to form a watering basin at the edge of and following the shape of the planting pit area. Mounds for trees and for vines from 5-gallon or larger containers, shall be at least 4" high. Mounds for all other trees, vines, or plants not otherwise specified shall be at least 4" high. Excavated earth, if capable of retaining water, may be used. Any settlement within the basins after watering, shall be refilled to the required grade with prepared soil, and additional nitrogen-stabilized sawdust worked into the surface as to restore the mulched condition. B. At the end of the 90 day maintenance period all watering basins in lawn areas shall be leveled to finish grade and the area shall be sodded with the specified sod. 18. WATERING A. Immediately after planting, water shall be applied to each tree by means of a hose. The water shall be applied on a moderate stream in the planting holes until the material about the roots is completely saturated from the bottom of the hole to the top of the ground. B. Plants which cannot be watered efficiently with the existing water system shall be watered by means of a hose. C. Apply water in sufficient quantities, and as often as seasonal conditions require, to keep the ground wet at all times, well below the root system of grass and planting. Care is to be taken in watering slopes so as not to cause erosion damage. D. Following the planting of ground cover plants furnished in flats, each plant shall be immediately and thoroughly watered by means of a hose with a slow-running stream of water. 19. TREE STAKING A. Stake all trees, not to be guyed at time of planting, by placing stake in the prepared hole and driving stake 18" into solid ground. Plant the tree as close to the stake as possible without crowding the roots. Fasten the tree to the upper end of the stake in at least three (3) places, using method specified in construction drawings. B. Trees, 36" box size or larger, shall be guyed per landscape architects recommendations. Use not less than three guys per tree, or as directed by the Landscape Architect. 1. Protect bark of tree by covering wire with green 1/2" diameter new rubber hose. 2. Guys to be anchored with "Duck Bill" type anchors or approved equal. 3. Guy wires shall be #12 ga. galvanized wire. Mark guys with 3'-0" long 1/2" dia. white PVC pipe. 20. ROOT BARRIERS A. All trees planted within 5'-0" of hardscape areas (i.e. walls, sidewalks, buildings, structures, etc.) shall be planted with deep root 18" linear barrier L8 18-2. B. Barrier shall be the length of the ultimate canopy width. 21. ESPALIERING OF VINES A. All trellises and stakes are to be removed from plants, and the plants shall be fastened and trained against fences or walls as directed by the Landscape Architect. 22. CERTIFICATES In addition to any other certificates specified, the Contractor shall furnish a certificate with each delivery of bulk material, stating the source, quantity, any type of material and that the material conforms to the specification requirements. For bulk delivered organic fertilizer, the certificate shall also state the volume, net weight, percent of nitrogen, percent of phosphoric acid. For each fertilizer and soil conditioner, in containers, a similar certificate of invoice shall be furnished stating total quantities by weight and volume for each material. These certificates shall be submitted to the Landscape Architect and the Owner prior to the start of the maintenance period. 23. PROTECTION The Contractor shall carefully and continuously protect all areas included in the contract, including plant materials, fences, supports, etc., until final acceptance of the work by the Landscape Architect and Owner. 24. MAINTENANCE A. The Contractor shall maintain a sufficient number of personnel and adequate equipment to perform the work herein specified. Plant maintenance work shall consist of applying water, weeding, caring for plants, including ground covers, shrubs and trees, edging, aerating, and mowing of lawns, fertilizing and control of pests and diseases. B. Damage to any planted area shall be repaired immediately. Depressions caused by vehicles or foot traffic shall be filled with topsoil, leveled and replanted. Exterminate gophers and moles, and repair damage. C. The entire project shall be maintained for a period of 90 days, commencing from the time all items of work have been completed to the satisfaction of the Landscape Architect and the Owner. D. The project shall be so cared for that a neat and clean condition will be presented at all times to the satisfaction of the Owner and the Landscape Architect. 25. LAWN MAINTENANCE A. Watering: Water every day once per day for two (2) weeks thereafter and then gradually reduce frequency of watering to three (3) times per week. The Contractor shall continue to maintain the lawn until the final acceptance by the Landscape Architect and the Owner. B. Fertilizing: Apply 16-6-8 at the rate of 6 pounds per 1,000 square feet three (3) weeks after installation and water immediately thereafter. C. Diseases and Pest Control: Two (2) weeks after installation of lawn, apply a granular mercurial fungicide of 1.8% mircurous chloride as per manufacturer's recommendation. D. Mowing: The lawn shall be mowed at a height of 1-1/2" with a rotary mow, equipped with rollers, before it reaches 2" in height. Collect grass clippings during mowing operations and remove from the site. After each cutting, the edge of the grass shall be trimmed to a neat and uniform line. The lawn edges shall be maintained in a neat condition at all times. LANDSCAPE CONSTRUCTION (Continued) 26. GROUND COVER AND SHRUB MAINTENANCE A. Watering: New plantings shall be watered once per day for two (2) weeks after installation. Reduce watering to every other day for the next two (2) weeks. Water thereafter three (3) times per week until final acceptance. B. Fertilization: Fertilize three (3) weeks after planting with 5 pounds 16-6-8 per 1,000 square feet; fertilize thereafter every 30 days. C. Diseases and Pest Control: For control of slugs and snails, apply palletized tricalcium arsenate 5% by weight as per manufacturer's recommendations two (2) weeks after installation. For control of cutworms and other soil insects, apply Metro brand soildrin as per manufacturer's recommendations two (2) weeks after installation. This product contains Dieldrin, Lindane and Phosphorothioate. Exterminate gophers and moles and repair damages. D. Pruning: All shrubs and trees shall be pinch pruned as necessary to encourage new growth and to eliminate rank sucker growth. Old flowers, dead foliage and limbs shall be removed. No major pruning shall be done without the approval of the Landscape Architect. E. Weeding: All planting areas including lawn, ground cover, and shrub areas, shall be kept weed-free at all times. Weeds shall be dug out by the roots and disposed of off the site. F. Upon completion of the 90 day maintenance period, the Contractor shall fertilize per this section. 28. CLEAN UP Upon completion of the work in this section, Contractor shall remove all rubbish, trash, and debris resulting from the the operations, remove disused equipment and and implements of service; leave entire area involved in a neat and acceptable condition such as to meet approval of Landscape Architect. 29. HYDROSEEDING (GROUND COVER AND TURF) Material Application and Equipment a. Mixing shall be performed in a tank with a built-in continuous agitation and recirculation system of sufficient operating capacity to produce a homogeneous slurry of fiber, seed, fertilizer and water in the designated proportions and a discharge system which will apply the slurry to the area to be treated at a continuous and uniform rate. b. Loading and mixing: With agitation system operating at part speed, water shall be added to the tank and a good circulation shall be established. Materials shall be added to the tanks in such a manner that they are uniformly blended into the mixture in the following sequence: 4,100 gal. water/acre (1,500 gal. tank - 3 tanks/acre) 1,500 lbs./acre Con-wed fiber 100 lbs./acre Ecology Control M Binder 300 lbs./acre 12-12-12 commercial fertilizer 100 lbs./acre soil sulfur 30. WEED ABATEMENT PROGRAM Upon completion of the irrigation system and after all existing weeds have been removed from the planting areas, the following weed prevention shall be used: Apply fertilizer mixture by spray per acre as follows: 300 lbs. 12-12-12 commercial fertilizer 300 lbs. urea formaldehyde 1,000 lbs. agricultural gypsum Apply post-emergent herbicide as recommended by a licensed pest control advisor to be compatible with the seeded plant varieties. Apply mixtures per the following time schedule: Fertilize/Water 21 days Wait 2 days Spray the post-emergent Pest control Advisor recommendations 7-10 days Fertilize/Water 14 days Spray Weed Mixture 7 days Fertilize/Water 14 days Spray Weed Mixture 7 days Grub/clean all areas to prepare for seeding plant 23 days max. TOTAL:100 days max. SOILS TEST NOTE The landscape contractor shall provide for and have performed a site-specific agronomic soils test report on samples taken from at least four (4) separate areas contained in this project. The soils test shall include recommendations for amendments to ground cover areas, tree/shrub backfill, and hydro-mulch formula. The contractor shall provide Landscape Architect, Owner, and appropriate government agency with one (1) copy each of said report for review prior to start of construction. SPECIFICATIONS 56#(( L-9